Lineage for d5xfwd1 (5xfw D:1-313)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2827845Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 2828459Family c.1.4.0: automated matches [191310] (1 protein)
    not a true family
  6. 2828460Protein automated matches [190048] (31 species)
    not a true protein
  7. 2828731Species Trypanosoma brucei [TaxId:185431] [351520] (2 PDB entries)
  8. 2828735Domain d5xfwd1: 5xfw D:1-313 [351521]
    Other proteins in same PDB: d5xfwd2
    automated match to d2b4gb_
    complexed with mli

Details for d5xfwd1

PDB Entry: 5xfw (more details), 1.6 Å

PDB Description: crystal structures of fmn-free form of dihydroorotate dehydrogenase from trypanosoma brucei
PDB Compounds: (D:) Dihydroorotate dehydrogenase (fumarate)

SCOPe Domain Sequences for d5xfwd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xfwd1 c.1.4.0 (D:1-313) automated matches {Trypanosoma brucei [TaxId: 185431]}
mslkvnilghefsnpfmnaagvlctteedlrrmtesesgsligksctlaprtgnpepryf
glplgsinsmglpnlgvdfylsyaaqthdysrkplflsmsglsveesvemvkklvpitke
kgtilelnlscpnvpgkpqvgydfdttrtylqkvseayglpfgvkmppyfdiahfdmaaa
vlndfplvkfitcvnsignglvidpanetvvikpkqgfgglggkyvlptalanvnaffrr
cpdklvfgcggvysgeeaflhilagasmvqvgtalhdegpiifarlnkelqeimtnkgyk
tldefrgrvktmd

SCOPe Domain Coordinates for d5xfwd1:

Click to download the PDB-style file with coordinates for d5xfwd1.
(The format of our PDB-style files is described here.)

Timeline for d5xfwd1: