Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) |
Family c.1.4.0: automated matches [191310] (1 protein) not a true family |
Protein automated matches [190048] (31 species) not a true protein |
Species Trypanosoma brucei [TaxId:185431] [351520] (2 PDB entries) |
Domain d5xfwd1: 5xfw D:1-313 [351521] Other proteins in same PDB: d5xfwd2 automated match to d2b4gb_ complexed with mli |
PDB Entry: 5xfw (more details), 1.6 Å
SCOPe Domain Sequences for d5xfwd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5xfwd1 c.1.4.0 (D:1-313) automated matches {Trypanosoma brucei [TaxId: 185431]} mslkvnilghefsnpfmnaagvlctteedlrrmtesesgsligksctlaprtgnpepryf glplgsinsmglpnlgvdfylsyaaqthdysrkplflsmsglsveesvemvkklvpitke kgtilelnlscpnvpgkpqvgydfdttrtylqkvseayglpfgvkmppyfdiahfdmaaa vlndfplvkfitcvnsignglvidpanetvvikpkqgfgglggkyvlptalanvnaffrr cpdklvfgcggvysgeeaflhilagasmvqvgtalhdegpiifarlnkelqeimtnkgyk tldefrgrvktmd
Timeline for d5xfwd1: