Lineage for d6eqea1 (6eqe A:29-290)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. Protein automated matches [190543] (128 species)
    not a true protein
  7. Species Ideonella sakaiensis [TaxId:1547922] [343272] (26 PDB entries)
  8. Domain d6eqea1: 6eqe A:29-290 [351487]
    Other proteins in same PDB: d6eqea2
    automated match to d5xfya_
    complexed with cl, na

Details for d6eqea1

PDB Entry: 6eqe (more details), 0.92 Å

PDB Description: high resolution crystal structure of a polyethylene terephthalate degrading hydrolase from ideonella sakaiensis
PDB Compounds: (A:) Poly(ethylene terephthalate) hydrolase

SCOPe Domain Sequences for d6eqea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6eqea1 c.69.1.0 (A:29-290) automated matches {Ideonella sakaiensis [TaxId: 1547922]}
tnpyargpnptaasleasagpftvrsftvsrpsgygagtvyyptnaggtvgaiaivpgyt
arqssikwwgprlashgfvvitidtnstldqpssrssqqmaalrqvaslngtssspiygk
vdtarmgvmgwsmggggslisaannpslkaaapqapwdsstnfssvtvptlifacendsi
apvnssalpiydsmsrnakqfleinggshscansgnsnqaligkkgvawmkrfmdndtry
stfacenpnstrvsdfrtancs

SCOPe Domain Coordinates for d6eqea1 are not available.

Timeline for d6eqea1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6eqea2