SCOPe 2.08: Domain d6ck9e_: 6ck9 E:

Lineage for d6ck9e_ (6ck9 E:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d6ck9e_: 6ck9 E: [351480]
   Other proteins in same PDB: d6ck9h2, d6ck9l2
   automated match to d2rhea_
   complexed with nag

Details for d6ck9e_

PDB Entry: 6ck9, 2.71 Å

PDB Description: crystal structure of hiv-1 conc_base0 prefusion env trimer in complex with human antibody fragment 3h109l and 35o22 variants at 3.5 angstrom

PDB Compounds: (E:) 35O22 scFv light chain portion

SCOPe Domain Sequences for d6ck9e_:

Sequence, based on SEQRES records:

>d6ck9e_ b.1.1.0 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vltqsasvsgslgqsvtisctgpnsvccshksiswyqwppgraptliiyednerapgisp
rfsgyksywsayltisdlrpedettyyccsythnsgcvfgtgtkv

Sequence, based on observed residues (ATOM records):

>d6ck9e_ b.1.1.0 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vltqsasvsgslgqsvtisctgpnsvccshksiswyqwppgraptliiyednerapgisp
rfsgyksywsayltisdettyyccsythnsgcvfgtgtkv

Timeline for d6ck9e_:

• d6ck9e_ first appeared in SCOPe 2.07