Class a: All alpha proteins [46456] (289 folds) |
Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies) not a true fold |
Superfamily a.137.3: Transducin (heterotrimeric G protein), gamma chain [48670] (1 family) long alpha-helix interrupted in the middle automatically mapped to Pfam PF00631 |
Family a.137.3.1: Transducin (heterotrimeric G protein), gamma chain [48671] (2 proteins) |
Protein Transducin (heterotrimeric G protein), gamma chain [48672] (1 species) |
Species Cow (Bos taurus) [TaxId:9913] [48673] (56 PDB entries) |
Domain d6c2yg_: 6c2y G: [351475] Other proteins in same PDB: d6c2ya1, d6c2ya2, d6c2ya3, d6c2yb_ automated match to d2trcg_ complexed with ejs |
PDB Entry: 6c2y (more details), 2.74 Å
SCOPe Domain Sequences for d6c2yg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6c2yg_ a.137.3.1 (G:) Transducin (heterotrimeric G protein), gamma chain {Cow (Bos taurus) [TaxId: 9913]} asiaqarklveqlkmeanidrikvskaaadlmayceahakedplltpvpasenpfre
Timeline for d6c2yg_:
View in 3D Domains from other chains: (mouse over for more information) d6c2ya1, d6c2ya2, d6c2ya3, d6c2yb_ |