Lineage for d6c7ob_ (6c7o B:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2399102Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2399860Superfamily b.69.15: Retinal pigment epithelial membrane protein-like [310595] (1 family) (S)
    Pfam PF03055
  5. 2399861Family b.69.15.1: RPE65-like [310643] (2 proteins)
  6. 2399893Protein automated matches [310886] (2 species)
    not a true protein
  7. 2399906Species Synechocystis sp. [TaxId:1111708] [311494] (7 PDB entries)
  8. 3051409Domain d6c7ob_: 6c7o B: [351471]
    automated match to d5kjba_
    complexed with fe2

Details for d6c7ob_

PDB Entry: 6c7o (more details), 3.15 Å

PDB Description: crystal structure of d477g aco/rpe65 chimera, trigonal crystal form
PDB Compounds: (B:) Apocarotenoid-15,15'-oxygenase

SCOPe Domain Sequences for d6c7ob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6c7ob_ b.69.15.1 (B:) automated matches {Synechocystis sp. [TaxId: 1111708]}
qrsyspqdwlrgyqsqpqewdywvedvegsiplwlqgtlyrngpglleigdrplkhpfdg
dgmvtafkfpgdgrvhfqskfvrtqgyveeqkagkmiyrgvfgsqpaggwlktifdlrlk
niantnitywgdrllalweggqphrlepsnlatiglddlggilaegqplsahpridpast
fdggqpcyvtfsiksslsstltlleldpqgkllrqktetfpgfafihdfaitphyaiflq
nnvtlnglpylfglrgagecvqfhpdkpaqiilvprdggeikripvqagfvfhhanafee
ngkiildsicynslpqvdtdgdfrstnfdnldpgqlwrftidpaaatvekqlmvsrccef
pvvhpqqvgrpyryvymgaahhstgnaplqailkvdlesgtetlrsfaphgfagepifvs
hpgaleeddgvllcliykadlhrselvilnakditapaiatlklkhhipyplhgswaqt

SCOPe Domain Coordinates for d6c7ob_:

Click to download the PDB-style file with coordinates for d6c7ob_.
(The format of our PDB-style files is described here.)

Timeline for d6c7ob_:

  • d6c7ob_ is new in SCOPe 2.07-stable