Lineage for d6f60b_ (6f60 B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2498373Fold d.5: RNase A-like [54075] (1 superfamily)
    contains long curved beta-sheet and 3 helices
  4. 2498374Superfamily d.5.1: RNase A-like [54076] (2 families) (S)
    can be classified as disulfide-rich
  5. 2498375Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)
  6. 2498503Protein Ribonuclease A (also ribonuclease B, S) [54078] (4 species)
  7. 2498504Species Cow (Bos taurus) [TaxId:9913] [54079] (210 PDB entries)
  8. 3051408Domain d6f60b_: 6f60 B: [351470]
    automated match to d1kf3a_
    complexed with dvw, dw5, so4

Details for d6f60b_

PDB Entry: 6f60 (more details), 1.14 Å

PDB Description: the x-ray structure of bovine pancreatic ribonuclease in complex with a five-coordinate platinum(ii) compound containing a sugar ligand
PDB Compounds: (B:) ribonuclease pancreatic

SCOPe Domain Sequences for d6f60b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6f60b_ d.5.1.1 (B:) Ribonuclease A (also ribonuclease B, S) {Cow (Bos taurus) [TaxId: 9913]}
ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
dasv

SCOPe Domain Coordinates for d6f60b_:

Click to download the PDB-style file with coordinates for d6f60b_.
(The format of our PDB-style files is described here.)

Timeline for d6f60b_:

  • d6f60b_ is new in SCOPe 2.07-stable