Lineage for d1nbea2 (1nbe A:151-310)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 27322Fold c.78: ATC-like [53670] (2 superfamilies)
  4. 27323Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (1 family) (S)
  5. 27324Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (2 proteins)
  6. 27325Protein Aspartate carbamoyltransferase catalytic subunit [53673] (2 species)
  7. 27333Species Escherichia coli [TaxId:562] [53674] (27 PDB entries)
  8. 27383Domain d1nbea2: 1nbe A:151-310 [35145]
    Other proteins in same PDB: d1nbeb1, d1nbeb2, d1nbed1, d1nbed2

Details for d1nbea2

PDB Entry: 1nbe (more details), 2.6 Å

PDB Description: aspartate transcarbamoylase regulatory chain mutant (t82a)

SCOP Domain Sequences for d1nbea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nbea2 c.78.1.1 (A:151-310) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli}
rldnlhvamvgdlkygrtvhsltqalakfdgnrfyfiapdalampeyildmldekgiaws
lhssieevmaevdilymtrvqkerldpseyanvkaqfvlrasdlhnakanmkvlhplprv
deiatdvdktphawyfqqagngifarqallalvlnrdlvl

SCOP Domain Coordinates for d1nbea2:

Click to download the PDB-style file with coordinates for d1nbea2.
(The format of our PDB-style files is described here.)

Timeline for d1nbea2: