Lineage for d6eqgc1 (6eqg C:29-290)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2899459Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2899460Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2901917Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2901918Protein automated matches [190543] (131 species)
    not a true protein
  7. 2902426Species Ideonella sakaiensis [TaxId:1547922] [343272] (26 PDB entries)
  8. 2902457Domain d6eqgc1: 6eqg C:29-290 [351447]
    Other proteins in same PDB: d6eqgc2
    automated match to d5xfya_
    complexed with cl, so4

Details for d6eqgc1

PDB Entry: 6eqg (more details), 1.8 Å

PDB Description: crystal structure of a polyethylene terephthalate degrading hydrolase from ideonella sakaiensis in spacegroup p21
PDB Compounds: (C:) Poly(ethylene terephthalate) hydrolase

SCOPe Domain Sequences for d6eqgc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6eqgc1 c.69.1.0 (C:29-290) automated matches {Ideonella sakaiensis [TaxId: 1547922]}
tnpyargpnptaasleasagpftvrsftvsrpsgygagtvyyptnaggtvgaiaivpgyt
arqssikwwgprlashgfvvitidtnstldqpssrssqqmaalrqvaslngtssspiygk
vdtarmgvmgwsmggggslisaannpslkaaapqapwdsstnfssvtvptlifacendsi
apvnssalpiydsmsrnakqfleinggshscansgnsnqaligkkgvawmkrfmdndtry
stfacenpnstrvsdfrtancs

SCOPe Domain Coordinates for d6eqgc1:

Click to download the PDB-style file with coordinates for d6eqgc1.
(The format of our PDB-style files is described here.)

Timeline for d6eqgc1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6eqgc2