Lineage for d6eqdc1 (6eqd C:29-290)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2507025Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2507026Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2509433Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2509434Protein automated matches [190543] (124 species)
    not a true protein
  7. 2509925Species Ideonella sakaiensis [TaxId:1547922] [343272] (26 PDB entries)
  8. 2509951Domain d6eqdc1: 6eqd C:29-290 [351437]
    Other proteins in same PDB: d6eqda2, d6eqdb2, d6eqdc2
    automated match to d5xfya_
    complexed with cl

Details for d6eqdc1

PDB Entry: 6eqd (more details), 1.7 Å

PDB Description: crystal structure of a polyethylene terephthalate degrading hydrolase from ideonella sakaiensis collected at long wavelength
PDB Compounds: (C:) Poly(ethylene terephthalate) hydrolase

SCOPe Domain Sequences for d6eqdc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6eqdc1 c.69.1.0 (C:29-290) automated matches {Ideonella sakaiensis [TaxId: 1547922]}
tnpyargpnptaasleasagpftvrsftvsrpsgygagtvyyptnaggtvgaiaivpgyt
arqssikwwgprlashgfvvitidtnstldqpssrssqqmaalrqvaslngtssspiygk
vdtarmgvmgwsmggggslisaannpslkaaapqapwdsstnfssvtvptlifacendsi
apvnssalpiydsmsrnakqfleinggshscansgnsnqaligkkgvawmkrfmdndtry
stfacenpnstrvsdfrtancs

SCOPe Domain Coordinates for d6eqdc1:

Click to download the PDB-style file with coordinates for d6eqdc1.
(The format of our PDB-style files is described here.)

Timeline for d6eqdc1: