Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) many members have left-handed crossover connection between strand 8 and additional strand 9 |
Family c.69.1.0: automated matches [191404] (1 protein) not a true family |
Protein automated matches [190543] (124 species) not a true protein |
Species Ideonella sakaiensis [TaxId:1547922] [343272] (26 PDB entries) |
Domain d6eqdc1: 6eqd C:29-290 [351437] Other proteins in same PDB: d6eqda2, d6eqdb2, d6eqdc2 automated match to d5xfya_ complexed with cl |
PDB Entry: 6eqd (more details), 1.7 Å
SCOPe Domain Sequences for d6eqdc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6eqdc1 c.69.1.0 (C:29-290) automated matches {Ideonella sakaiensis [TaxId: 1547922]} tnpyargpnptaasleasagpftvrsftvsrpsgygagtvyyptnaggtvgaiaivpgyt arqssikwwgprlashgfvvitidtnstldqpssrssqqmaalrqvaslngtssspiygk vdtarmgvmgwsmggggslisaannpslkaaapqapwdsstnfssvtvptlifacendsi apvnssalpiydsmsrnakqfleinggshscansgnsnqaligkkgvawmkrfmdndtry stfacenpnstrvsdfrtancs
Timeline for d6eqdc1:
View in 3D Domains from other chains: (mouse over for more information) d6eqda1, d6eqda2, d6eqdb1, d6eqdb2 |