SCOPe 2.08: Domain d6ci0b2: 6ci0 B:130-281

Lineage for d6ci0b2 (6ci0 B:130-281)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (3 proteins)

6. Protein Cytochrome c oxidase [49544] (4 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [74870] (7 PDB entries)

8. Domain d6ci0b2: 6ci0 B:130-281 [351416]
   Other proteins in same PDB: d6ci0a_, d6ci0b1, d6ci0b3, d6ci0c_, d6ci0d1, d6ci0d3
   automated match to d1m56b1
   complexed with ca, cd, cu, dmu, hea, hth, k, mg, trd, trs; mutant

Details for d6ci0b2

PDB Entry: 6ci0, 2.4 Å

PDB Description: catalytic core subunits (i and ii) of cytochrome c oxidase from rhodobacter sphaeroides with e101a (ii) mutation

PDB Compounds: (B:) Cytochrome c oxidase subunit 2

SCOPe Domain Sequences for d6ci0b2:

Sequence; same for both SEQRES and ATOM records:

>d6ci0b2 b.6.1.2 (B:130-281) Cytochrome c oxidase {Rhodobacter sphaeroides [TaxId: 1063]}
peadvtvkvtgyqwywgyeypdeeisfesymigspatggdnrmspeveqqlieagysrde
fllatdtamvvpvnktvvvqvtgadvihswtvpafgvkqdavpgrlaqlwfraeregiff
gqcselcgishaympitvkvvseeayaawleq

Timeline for d6ci0b2:

• d6ci0b2 first appeared in SCOPe 2.07