Lineage for d6ck9l2 (6ck9 L:108-209)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2749887Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
  8. 2751546Domain d6ck9l2: 6ck9 L:108-209 [351415]
    Other proteins in same PDB: d6ck9d_, d6ck9e_, d6ck9h1, d6ck9h2, d6ck9l1
    automated match to d1jvka2
    complexed with nag

Details for d6ck9l2

PDB Entry: 6ck9 (more details), 2.71 Å

PDB Description: crystal structure of hiv-1 conc_base0 prefusion env trimer in complex with human antibody fragment 3h109l and 35o22 variants at 3.5 angstrom
PDB Compounds: (L:) 3H109L Fab light chain

SCOPe Domain Sequences for d6ck9l2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ck9l2 b.1.1.2 (L:108-209) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskq
snnkyaassylsltpmqwkmhksyscqvthegstvektvapt

SCOPe Domain Coordinates for d6ck9l2:

Click to download the PDB-style file with coordinates for d6ck9l2.
(The format of our PDB-style files is described here.)

Timeline for d6ck9l2:

2751546
d6ck9l2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d6ck9l1