Lineage for d6blal1 (6bla L:2-111)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2754608Domain d6blal1: 6bla L:2-111 [351411]
    Other proteins in same PDB: d6blal2
    automated match to d1lila1
    complexed with 2pe, cl, edo, gol, peg, trs

Details for d6blal1

PDB Entry: 6bla (more details), 1.55 Å

PDB Description: structure of amm01 fab, an anti ebv gh/gl neutralizing antibody
PDB Compounds: (L:) AMM01 Fab Light chain

SCOPe Domain Sequences for d6blal1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6blal1 b.1.1.0 (L:2-111) automated matches {Human (Homo sapiens) [TaxId: 9606]}
yeltqppsvsvapgqratitcgghnigaknvhwyqqkpgqapvlviqydsdrpsgiperf
sgsnsgstatltisrveagdeadyycqvwdsgrghplyvfgggtkvtvlg

SCOPe Domain Coordinates for d6blal1:

Click to download the PDB-style file with coordinates for d6blal1.
(The format of our PDB-style files is described here.)

Timeline for d6blal1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6blal2
View in 3D
Domains from other chains:
(mouse over for more information)
d6blah_