Lineage for d6ck9d_ (6ck9 D:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. Protein automated matches [190740] (30 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1747 PDB entries)
  8. Domain d6ck9d_: 6ck9 D: [351406]
    Other proteins in same PDB: d6ck9h2, d6ck9l2
    automated match to d5c1mb_
    complexed with nag

Details for d6ck9d_

PDB Entry: 6ck9 (more details), 2.71 Å

PDB Description: crystal structure of hiv-1 conc_base0 prefusion env trimer in complex with human antibody fragment 3h109l and 35o22 variants at 3.5 angstrom
PDB Compounds: (D:) 35O22 scFv heavy chain portion

SCOPe Domain Sequences for d6ck9d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ck9d_ b.1.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qgqlvqsgatttkpgssvkiscktsgyrfnfyhinwirqtagrgpewmgwispysgdknl
apafqdrvimttdtevpvtsftstgaaymeirnltsddtgtyfcakgllrdgsstwlpyl
wgqgtllt

SCOPe Domain Coordinates for d6ck9d_ are not available.

Timeline for d6ck9d_:

View in 3D
Domains from other chains:
(mouse over for more information)
d6ck9e_, d6ck9h1, d6ck9h2, d6ck9l1, d6ck9l2