Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
Fold f.24: Cytochrome c oxidase subunit I-like [81443] (1 superfamily) 12 transmembrane helices in an approximate threefold rotational symmetric arrangement |
Superfamily f.24.1: Cytochrome c oxidase subunit I-like [81442] (1 family) |
Family f.24.1.1: Cytochrome c oxidase subunit I-like [81441] (5 proteins) the largest and best conserved subunit, contains two heme groups, low spin heme a and high spin heme a3 |
Protein automated matches [190134] (4 species) not a true protein |
Species Rhodobacter sphaeroides [TaxId:1063] [351403] (1 PDB entry) |
Domain d6ci0c_: 6ci0 C: [351405] Other proteins in same PDB: d6ci0b1, d6ci0b2, d6ci0b3, d6ci0d1, d6ci0d2, d6ci0d3 automated match to d3omaa_ complexed with ca, cd, cu, dmu, hea, hth, k, mal, mg, trd, trs; mutant |
PDB Entry: 6ci0 (more details), 2.4 Å
SCOPe Domain Sequences for d6ci0c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ci0c_ f.24.1.1 (C:) automated matches {Rhodobacter sphaeroides [TaxId: 1063]} wfmstnhkdigvlylftgglvglisvaftvymrmelmapgvqfmcaehlesglvkgffqs lwpsavenctpnghlwnvmitghgilmmffvvipalfggfgnyfmplhigapdmafprmn nlsywlyvagtslavaslfapggngqlgsgigwvlypplstsesgystdlaifavhlsga ssilgainmittflnmrapgmtmhkvplfawsifvtawlillalpvlagaitmlltdrnf gttffqpsgggdpvlyqhilwffghpevyiivlpafgivshviatfakkpifgylpmvya mvaigvlgfvvwahhmytaglsltqqsyfmmatmviavptgikifswiatmwggsielkt pmlwalgflflftvggvtgivlsqasvdryyhdtyyvvahfhyvmslgavfgifagiyfw igkmsgrqypewagklhfwmmfvganltffpqhflgrqgmprryidypeafatwnfvssl gaflsfasflfflgvifytltrgarvtannywnehadtlewtltspppeht
Timeline for d6ci0c_: