Lineage for d6b7ha1 (6b7h A:30-507)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2485265Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. 2485266Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. 2485563Family c.93.1.0: automated matches [191439] (1 protein)
    not a true family
  6. 2485564Protein automated matches [190646] (76 species)
    not a true protein
  7. 2485726Species Human (Homo sapiens) [TaxId:9606] [189363] (15 PDB entries)
  8. 3051338Domain d6b7ha1: 6b7h A:30-507 [351400]
    Other proteins in same PDB: d6b7ha2
    automated match to d4xara_
    complexed with ca, cwy, nag

Details for d6b7ha1

PDB Entry: 6b7h (more details), 2.82 Å

PDB Description: structure of mglur3 with an agonist
PDB Compounds: (A:) Metabotropic glutamate receptor 3

SCOPe Domain Sequences for d6b7ha1:

Sequence, based on SEQRES records: (download)

>d6b7ha1 c.93.1.0 (A:30-507) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rreikiegdlvlgglfpinekgtgteecgrinedrgiqrleamlfaideinkddyllpgv
klgvhildtcsrdtyaleqslefvrasltkvdeaeymcpdgsyaiqeniplliagviggs
yssvsiqvanllrlfqipqisyastsaklsdksrydyfartvppdfyqakamaeilrffn
wtyvstvasegdygetgieafeqearlrnisiataekvgrsnirksydsvirellqkpna
rvvvlfmrsddsreliaaasranasftwvasdgwgaqesiikgsehvaygaitlelasqp
vrqfdryfqslnpynnhrnpwfrdfweqkfqcslqnkrnhrrvcdkhlaidssnyeqesk
imfvvnavyamahalhkmqrtlcpnttklcdamkildgkklykdyllkinftapfnpnkd
adsivkfdtfgdgmgrynvfnfqnvggkysylkvghwaetlsldvnsihwsrnsvpts

Sequence, based on observed residues (ATOM records): (download)

>d6b7ha1 c.93.1.0 (A:30-507) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rreikigdlvlgglfpinekeecgrinedrgiqrleamlfaideinkddyllpgvklgvh
ildtcsrdtyaleqslefvraslplliagviggsyssvsiqvanllrlfqipqisyasts
aklsdksrydyfartvppdfyqakamaeilrffnwtyvstvasegdygetgieafeqear
lrnisiataekvgrsnirksydsvirellqkpnarvvvlfmrsddsreliaaasranasf
twvasdgwgaqesiikgsehvaygaitlelasqpvrqfdryfqslnpynnhrnpwfrdfw
eqkfqcslrvcdkhlaidssnyeqeskimfvvnavyamahalhkmqrtlcpnttklcdam
kildgkklykdyllkinftapdadsivkfdtfgdgmgrynvfnfqnvggkysylkvghwa
etlsldvnsihwsrnsvpts

SCOPe Domain Coordinates for d6b7ha1:

Click to download the PDB-style file with coordinates for d6b7ha1.
(The format of our PDB-style files is described here.)

Timeline for d6b7ha1:

  • d6b7ha1 is new in SCOPe 2.07-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d6b7ha2