Class a: All alpha proteins [46456] (290 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.0: automated matches [191420] (1 protein) not a true family |
Protein automated matches [190590] (26 species) not a true protein |
Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [269183] (4 PDB entries) |
Domain d6ciia_: 6cii A: [351399] automated match to d4xdia_ complexed with cyn, hem |
PDB Entry: 6cii (more details), 1.7 Å
SCOPe Domain Sequences for d6ciia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ciia_ a.1.1.0 (A:) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]} apadslysrmggeaavekavdvfyerivadpqlapffanvdmkkqrrkqvafmtyvfggs gayegrdlgashrrlireqgmnhhhfdlvaahldstlqelgvaqelkaeamaivasarpl ifgt
Timeline for d6ciia_: