Lineage for d6c7oa_ (6c7o A:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. Superfamily b.69.15: Retinal pigment epithelial membrane protein-like [310595] (1 family) (S)
    Pfam PF03055
  5. Family b.69.15.1: RPE65-like [310643] (2 proteins)
  6. Protein RPE65 [310786] (2 species)
  7. Species Synechocystis sp. [TaxId:1143] [311042] (12 PDB entries)
  8. Domain d6c7oa_: 6c7o A: [351397]
    automated match to d5kjba_
    complexed with fe2

Details for d6c7oa_

PDB Entry: 6c7o (more details), 3.15 Å

PDB Description: crystal structure of d477g aco/rpe65 chimera, trigonal crystal form
PDB Compounds: (A:) Apocarotenoid-15,15'-oxygenase

SCOPe Domain Sequences for d6c7oa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6c7oa_ b.69.15.1 (A:) RPE65 {Synechocystis sp. [TaxId: 1143]}
qrsyspqdwlrgyqsqpqewdywvedvegsiplwlqgtlyrngpglleigdrplkhpfdg
dgmvtafkfpgdgrvhfqskfvrtqgyveeqkagkmiyrgvfgsqpaggwlktifdlrlk
niantnitywgdrllalweggqphrlepsnlatiglddlggilaegqplsahpridpast
fdggqpcyvtfsiksslsstltlleldpqgkllrqktetfpgfafihdfaitphyaiflq
nnvtlnglpylfglrgagecvqfhpdkpaqiilvprdggeikripvqagfvfhhanafee
ngkiildsicynslpqvdtdgdfrstnfdnldpgqlwrftidpaaatvekqlmvsrccef
pvvhpqqvgrpyryvymgaahhstgnaplqailkvdlesgtetlrsfaphgfagepifvs
hpgaleeddgvllcliykadlhrselvilnakditapaiatlklkhhipyplhgswaqt

SCOPe Domain Coordinates for d6c7oa_ are not available.

Timeline for d6c7oa_:

Domains from other chains:
(mouse over for more information)
d6c7ob_