SCOPe 2.08: Domain d5yl2d1: 5yl2 D:1-243

Lineage for d5yl2d1 (5yl2 D:1-243)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families)
   automatically mapped to Pfam PF00091

5. Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)

6. Protein automated matches [226837] (9 species)
   not a true protein

7. Species Pig (Sus scrofa) [TaxId:9823] [278808] (66 PDB entries)

8. Domain d5yl2d1: 5yl2 D:1-243 [351379]
   Other proteins in same PDB: d5yl2a2, d5yl2b2, d5yl2c2, d5yl2d2, d5yl2e_, d5yl2f1, d5yl2f2, d5yl2f3
   automated match to d4drxb1
   complexed with 8wu, acp, ca, gdp, gol, gtp, mes, mg

Details for d5yl2d1

PDB Entry: 5yl2, 2.09 Å

PDB Description: crystal structure of t2r-ttl-y28 complex

PDB Compounds: (D:) Tubulin beta chain

SCOPe Domain Sequences for d5yl2d1:

Sequence; same for both SEQRES and ATOM records:

>d5yl2d1 c.32.1.1 (D:1-243) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
mreivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneatgnkyv
prailvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvv
rkesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvmpspkvsdtvv
epynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttcl
rfp

Timeline for d5yl2d1:

• d5yl2d1 first appeared in SCOPe 2.07