Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.30: PreATP-grasp domain [52439] (1 superfamily) 3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands possible rudiment form of Rossmann-fold domain |
Superfamily c.30.1: PreATP-grasp domain [52440] (10 families) precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function |
Family c.30.1.9: Tubulin tyrosine ligase (TTL) N-terminal domain-like [310625] (1 protein) |
Protein Tubulin tyrosine ligase (TTL) N-terminal domain [310727] (2 species) |
Species Chicken (Gallus gallus) [TaxId:9031] [311384] (170 PDB entries) |
Domain d5xkgf1: 5xkg F:1-76 [351373] Other proteins in same PDB: d5xkga1, d5xkga2, d5xkgb1, d5xkgb2, d5xkgc1, d5xkgc2, d5xkgd1, d5xkgd2, d5xkge_, d5xkgf2, d5xkgf3 automated match to d3tiia1 complexed with 890, ca, gdp, gol, gtp, mes, mg |
PDB Entry: 5xkg (more details), 2.2 Å
SCOPe Domain Sequences for d5xkgf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5xkgf1 c.30.1.9 (F:1-76) Tubulin tyrosine ligase (TTL) N-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} mytfvvrdenssvyaevsrlllatgqwkrlrkdnprfnlmlgernrlpfgrlghepglvq lvnyyrgadklcrkas
Timeline for d5xkgf1: