SCOPe 2.08: Domain d5xqwl1: 5xqw L:1-107

Lineage for d5xqwl1 (5xqw L:1-107)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)

8. Domain d5xqwl1: 5xqw L:1-107 [351370]
   Other proteins in same PDB: d5xqwl2
   automated match to d1c12a1
   complexed with 8eu

Details for d5xqwl1

PDB Entry: 5xqw, 2.2 Å

PDB Description: catalytic antibody 7b9

PDB Compounds: (L:) Fab fragment of catalytic antibody 7B9, light chain

SCOPe Domain Sequences for d5xqwl1:

Sequence; same for both SEQRES and ATOM records:

>d5xqwl1 b.1.1.1 (L:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dilmtqqpssmsvslgdtvtitchasqgirsnigwlqqkpgksfkgliylgtnledevps
rfsgsgsgadysltisslesedfadyycvqyaqfprtfgggtrleik

Timeline for d5xqwl1:

• d5xqwl1 first appeared in SCOPe 2.07