![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
![]() | Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) ![]() |
![]() | Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins) |
![]() | Protein automated matches [227071] (7 species) not a true protein |
![]() | Species Pig (Sus scrofa) [TaxId:9823] [278816] (66 PDB entries) |
![]() | Domain d5xiwc2: 5xiw C:246-440 [351360] Other proteins in same PDB: d5xiwa1, d5xiwb1, d5xiwc1, d5xiwd1, d5xiwe_, d5xiwf1, d5xiwf2, d5xiwf3 automated match to d4i50a2 complexed with ca, gdp, gol, gtp, loc, mes, mg |
PDB Entry: 5xiw (more details), 2.9 Å
SCOPe Domain Sequences for d5xiwc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5xiwc2 d.79.2.1 (C:246-440) automated matches {Pig (Sus scrofa) [TaxId: 9823]} galnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkc dprhgkymaccllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpptvvpg gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm aalekdyeevgvdsv
Timeline for d5xiwc2: