SCOPe 2.06: Domain d1raha1: 1rah A:1-150

Lineage for d1raha1 (1rah A:1-150)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.78: ATC-like [53670] (2 superfamilies)
   consists of two similar domains related by pseudo dyad; duplication
   core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families)

5. Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (4 proteins)

6. Protein Aspartate carbamoyltransferase catalytic subunit [53673] (7 species)

7. Species Escherichia coli [TaxId:562] [53674] (63 PDB entries)
   Uniprot P00479

8. Domain d1raha1: 1rah A:1-150 [35136]
   Other proteins in same PDB: d1rahb1, d1rahb2, d1rahd1, d1rahd2
   complexed with ctp, zn; mutant

Details for d1raha1

PDB Entry: 1rah, 2.5 Å

PDB Description: crystal structure of ctp-ligated t state aspartate transcarbamoylase at 2.5 angstroms resolution: implications for atcase mutants and the mechanism of negative cooperativity

PDB Compounds: (A:) Aspartate carbamoyltransferase catalytic chain

SCOPe Domain Sequences for d1raha1:

Sequence; same for both SEQRES and ATOM records:

>d1raha1 c.78.1.1 (A:1-150) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli [TaxId: 562]}
anplyqkhiisindlsrddlnlvlataaklkanpqpellkhkviascffeastrtrlsfe
tsmhrlgasvvgfsdsantslgkkgetladtisvistyvdaivmrhpqegaarlatefsg
nvpvlnagdgsnqhptqtlldlftiqetqg

Timeline for d1raha1:

• d1raha1 first appeared (with stable ids) in SCOP 1.55
  
• d1raha1 appears in SCOPe 2.05
  
• d1raha1 appears in SCOPe 2.07
  
• d1raha1 appears in the current release, SCOPe 2.08