Lineage for d6ehst_ (6ehs T:)

  1. Root: SCOPe 2.07
  2. 2618030Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2624627Fold e.19: HydA/Nqo6-like [56769] (1 superfamily)
    2 domains: (1) alpa/beta; (2) Fe-S cluster-bound
  4. 2624628Superfamily e.19.1: HydA/Nqo6-like [56770] (3 families) (S)
  5. 2624800Family e.19.1.0: automated matches [191636] (1 protein)
    not a true family
  6. 2624801Protein automated matches [191172] (11 species)
    not a true protein
  7. 2624846Species Escherichia coli [TaxId:585055] [351193] (1 PDB entry)
  8. 2624848Domain d6ehst_: 6ehs T: [351341]
    Other proteins in same PDB: d6ehsl_, d6ehsm_
    automated match to d3myrc_
    complexed with dtn, f3s, fco, mg, ni, sf4

Details for d6ehst_

PDB Entry: 6ehs (more details), 1.5 Å

PDB Description: e. coli hydrogenase-2 chemically reduced structure
PDB Compounds: (T:) HybO protein

SCOPe Domain Sequences for d6ehst_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ehst_ e.19.1.0 (T:) automated matches {Escherichia coli [TaxId: 585055]}
pqrppviwigaqectgctesllrathptvenlvletisleyhevlsaafghqveenkhna
lekykgqyvlvvdgsiplkdngiycmvagepivdhirkaaegaaaiiaigscsawggvaa
agvnptgavslqevlpgktvinipgcppnphnflatvahiitygkppklddknrptfayg
rlihehcerrphfdagrfakefgdeghregwclyhlgckgpetygncstlqfcdvggvwp
vaighpcygcneegigfhkgihqlanve

SCOPe Domain Coordinates for d6ehst_:

Click to download the PDB-style file with coordinates for d6ehst_.
(The format of our PDB-style files is described here.)

Timeline for d6ehst_: