SCOPe 2.07: Domain d5vkxa1: 5vkx A:14-134

Lineage for d5vkxa1 (5vkx A:14-134)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.61: Streptavidin-like [50875] (8 superfamilies)
   barrel, closed; n=8, S=10; meander

4. Superfamily b.61.1: Avidin/streptavidin [50876] (2 families)

5. Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)

6. Protein automated matches [190191] (2 species)
   not a true protein

7. Species Streptomyces avidinii [TaxId:1895] [189343] (64 PDB entries)

8. Domain d5vkxa1: 5vkx A:14-134 [351334]
   Other proteins in same PDB: d5vkxa2
   automated match to d2bc3b_
   complexed with cu, gol, s18

Details for d5vkxa1

PDB Entry: 5vkx, 1.37 Å

PDB Description: coordination chemistry within a protein host: regulation of the secondary coordination sphere

PDB Compounds: (A:) streptavidin

SCOPe Domain Sequences for d5vkxa1:

Sequence; same for both SEQRES and ATOM records:

>d5vkxa1 b.61.1.1 (A:14-134) automated matches {Streptomyces avidinii [TaxId: 1895]}
eagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtal
gwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkv
k

Timeline for d5vkxa1:

• d5vkxa1 appears in periodic updates to SCOPe 2.07 starting on 2018-04-19