Lineage for d5vkxa1 (5vkx A:14-134)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2396657Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 2396658Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) (S)
  5. 2396659Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)
  6. 2396981Protein automated matches [190191] (2 species)
    not a true protein
  7. 2397072Species Streptomyces avidinii [TaxId:1895] [189343] (64 PDB entries)
  8. 3051272Domain d5vkxa1: 5vkx A:14-134 [351334]
    Other proteins in same PDB: d5vkxa2
    automated match to d2bc3b_
    complexed with cu, gol, s18

Details for d5vkxa1

PDB Entry: 5vkx (more details), 1.37 Å

PDB Description: coordination chemistry within a protein host: regulation of the secondary coordination sphere
PDB Compounds: (A:) streptavidin

SCOPe Domain Sequences for d5vkxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vkxa1 b.61.1.1 (A:14-134) automated matches {Streptomyces avidinii [TaxId: 1895]}
eagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtal
gwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkv
k

SCOPe Domain Coordinates for d5vkxa1:

Click to download the PDB-style file with coordinates for d5vkxa1.
(The format of our PDB-style files is described here.)

Timeline for d5vkxa1:

  • d5vkxa1 appears in periodic updates to SCOPe 2.07 starting on 2018-04-19

View in 3D
Domains from same chain:
(mouse over for more information)
d5vkxa2