![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.61: Streptavidin-like [50875] (8 superfamilies) barrel, closed; n=8, S=10; meander |
![]() | Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) ![]() |
![]() | Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins) |
![]() | Protein automated matches [190191] (2 species) not a true protein |
![]() | Species Streptomyces avidinii [TaxId:1895] [189343] (100 PDB entries) |
![]() | Domain d5vkxa1: 5vkx A:14-134 [351334] Other proteins in same PDB: d5vkxa2 automated match to d2bc3b_ complexed with cu, gol, s18 |
PDB Entry: 5vkx (more details), 1.37 Å
SCOPe Domain Sequences for d5vkxa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5vkxa1 b.61.1.1 (A:14-134) automated matches {Streptomyces avidinii [TaxId: 1895]} eagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtal gwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkv k
Timeline for d5vkxa1: