SCOPe 2.08: Domain d6furc1: 6fur C:1-112

Lineage for d6furc1 (6fur C:1-112)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d6furc1: 6fur C:1-112 [351327]
   Other proteins in same PDB: d6fura2, d6furc2
   automated match to d2ak4d1
   complexed with edo, gol, so4

Details for d6furc1

PDB Entry: 6fur, 1.73 Å

PDB Description: f11 t-cell receptor recognising pkyvkqntlklat peptide presented by hla-dr*0101

PDB Compounds: (C:) Human F11 T-Cell Receptor alpha chain

SCOPe Domain Sequences for d6furc1:

Sequence; same for both SEQRES and ATOM records:

>d6furc1 b.1.1.0 (C:1-112) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aqsvtqlgshvsvsegalvllrcnysssvppylfwyvqypnqglqlllkytsaatlvkgi
ngfeaefkksetsfhltkpsahmsdaaeyfcavseqddkiifgkgtrlhilp

Timeline for d6furc1:

• d6furc1 first appeared in SCOPe 2.07