Lineage for d8atca1 (8atc A:1-150)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 493140Fold c.78: ATC-like [53670] (2 superfamilies)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134
  4. 493141Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (1 family) (S)
  5. 493142Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (3 proteins)
  6. 493143Protein Aspartate carbamoyltransferase catalytic subunit [53673] (4 species)
  7. 493157Species Escherichia coli [TaxId:562] [53674] (36 PDB entries)
  8. 493198Domain d8atca1: 8atc A:1-150 [35132]

Details for d8atca1

PDB Entry: 8atc (more details), 2.5 Å

PDB Description: complex of n-phosphonacetyl-l-aspartate with aspartate carbamoyltransferase. x-ray refinement, analysis of conformational changes and catalytic and allosteric mechanisms

SCOP Domain Sequences for d8atca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d8atca1 c.78.1.1 (A:1-150) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli}
anplyqkhiisindlsrddlnlvlataaklkanpqpellkhkviascffeastrtrlsfq
tsmhrlgasvvgfsdsantslgkkgetladtisvistyvdaivmrhpqegaarlatefsg
nvpvlnagdgsnqhptqtlldlftiqqteg

SCOP Domain Coordinates for d8atca1:

Click to download the PDB-style file with coordinates for d8atca1.
(The format of our PDB-style files is described here.)

Timeline for d8atca1:

View in 3D
Domains from same chain:
(mouse over for more information)
d8atca2