![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
![]() | Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) ![]() automatically mapped to Pfam PF00091 |
![]() | Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins) |
![]() | Protein automated matches [226837] (9 species) not a true protein |
![]() | Species Pig (Sus scrofa) [TaxId:9823] [278808] (66 PDB entries) |
![]() | Domain d5xiwd1: 5xiw D:1-243 [351313] Other proteins in same PDB: d5xiwa2, d5xiwb2, d5xiwc2, d5xiwd2, d5xiwe_, d5xiwf1, d5xiwf2, d5xiwf3 automated match to d4drxb1 complexed with ca, gdp, gol, gtp, loc, mes, mg |
PDB Entry: 5xiw (more details), 2.9 Å
SCOPe Domain Sequences for d5xiwd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5xiwd1 c.32.1.1 (D:1-243) automated matches {Pig (Sus scrofa) [TaxId: 9823]} mreivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneatgnkyv prailvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvv rkesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvmpspkvsdtvv epynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttcl rfp
Timeline for d5xiwd1: