Lineage for d5xiwe_ (5xiw E:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2339505Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
    not a true fold
  4. 2339704Superfamily a.137.10: Stathmin [101494] (1 family) (S)
    single long helix crosslinking four tubulin subunits
    automatically mapped to Pfam PF00836
  5. 2339705Family a.137.10.1: Stathmin [101495] (2 proteins)
  6. 2339706Protein Stathmin 4 [101496] (2 species)
  7. 2339707Species Norway rat (Rattus norvegicus) [TaxId:10116] [101497] (99 PDB entries)
  8. 3051243Domain d5xiwe_: 5xiw E: [351305]
    Other proteins in same PDB: d5xiwa1, d5xiwa2, d5xiwb1, d5xiwb2, d5xiwc1, d5xiwc2, d5xiwd1, d5xiwd2, d5xiwf1, d5xiwf2, d5xiwf3
    automated match to d4i55e_
    complexed with ca, gdp, gol, gtp, loc, mes, mg

Details for d5xiwe_

PDB Entry: 5xiw (more details), 2.9 Å

PDB Description: crystal structure of t2r-ttl-colchicine complex
PDB Compounds: (E:) Stathmin-4

SCOPe Domain Sequences for d5xiwe_:

Sequence, based on SEQRES records: (download)

>d5xiwe_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mevielnkctsgqsfevilkppsfdgvpefnaslprrrdpsleeiqkkleaaeerrkyqe
aellkhlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqe
kdkhaeevrknkelke

Sequence, based on observed residues (ATOM records): (download)

>d5xiwe_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mevielnkctsgqsfevilkppsdpsleeiqkkleaaeerrkyqeaellkhlaekreher
eviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqekdkhaeevrknkelk
e

SCOPe Domain Coordinates for d5xiwe_:

Click to download the PDB-style file with coordinates for d5xiwe_.
(The format of our PDB-style files is described here.)

Timeline for d5xiwe_:

  • d5xiwe_ appears in periodic updates to SCOPe 2.07 starting on 2018-04-19