SCOPe 2.08: Domain d5xiwe_: 5xiw E:

Lineage for d5xiwe_ (5xiw E:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily a.137.10: Stathmin [101494] (1 family)
   single long helix crosslinking four tubulin subunits
   automatically mapped to Pfam PF00836

5. Family a.137.10.1: Stathmin [101495] (2 proteins)

6. Protein Stathmin 4 [101496] (3 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [101497] (185 PDB entries)

8. Domain d5xiwe_: 5xiw E: [351305]
   Other proteins in same PDB: d5xiwa1, d5xiwa2, d5xiwb1, d5xiwb2, d5xiwc1, d5xiwc2, d5xiwd1, d5xiwd2, d5xiwf1, d5xiwf2, d5xiwf3
   automated match to d4i55e_
   complexed with ca, gdp, gol, gtp, loc, mes, mg

Details for d5xiwe_

PDB Entry: 5xiw, 2.9 Å

PDB Description: crystal structure of t2r-ttl-colchicine complex

PDB Compounds: (E:) Stathmin-4

SCOPe Domain Sequences for d5xiwe_:

Sequence, based on SEQRES records:

>d5xiwe_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mevielnkctsgqsfevilkppsfdgvpefnaslprrrdpsleeiqkkleaaeerrkyqe
aellkhlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqe
kdkhaeevrknkelke

Sequence, based on observed residues (ATOM records):

>d5xiwe_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mevielnkctsgqsfevilkppsdpsleeiqkkleaaeerrkyqeaellkhlaekreher
eviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqekdkhaeevrknkelk
e

Timeline for d5xiwe_:

• d5xiwe_ first appeared in SCOPe 2.07