SCOPe 2.08: Domain d6eh7b2: 6eh7 B:112-240

Lineage for d6eh7b2 (6eh7 B:112-240)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d6eh7b2: 6eh7 B:112-240 [351297]
   Other proteins in same PDB: d6eh7a2
   automated match to d2nw2b2
   complexed with edo, peg

Details for d6eh7b2

PDB Entry: 6eh7, 1.89 Å

PDB Description: f11 human t-cell receptor specific for influenza virus haaemagglutinin epitope pkyvkqntlklat carried by human leukocyte antigen hla-dr0101

PDB Compounds: (B:) Human T Cell Receptor Beta Chain

SCOPe Domain Sequences for d6eh7b2:

Sequence; same for both SEQRES and ATOM records:

>d6eh7b2 b.1.1.0 (B:112-240) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlnkvsppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq
plkeqpalndsryslssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgrad

Timeline for d6eh7b2:

• d6eh7b2 first appeared in SCOPe 2.07