Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (31 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries) |
Domain d6eh8b1: 6eh8 B:2-115 [351294] Other proteins in same PDB: d6eh8a1, d6eh8a2, d6eh8b2 automated match to d3gsnb1 |
PDB Entry: 6eh8 (more details), 2.51 Å
SCOPe Domain Sequences for d6eh8b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6eh8b1 b.1.1.0 (B:2-115) automated matches {Human (Homo sapiens) [TaxId: 9606]} vkvtqssrylvkrtgekvflecvqdmdhenmfwyrqdpglglrliyfsydvkmkekgdip egysvsrekkerfslilesastnqtsmylcassstglpygytfgsgtrltvved
Timeline for d6eh8b1: