Lineage for d5wmtb_ (5wmt B:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. Family d.122.1.1: Heat shock protein 90, HSP90, N-terminal domain [55875] (2 proteins)
  6. Protein HSP90 [55876] (3 species)
  7. Species Dog (Canis familiaris) [TaxId:9615] [103225] (33 PDB entries)
    Uniprot P41148 76-285; Endoplasmin, GRP94
  8. Domain d5wmtb_: 5wmt B: [351293]
    automated match to d1tbwa_
    complexed with 9qy, edo, mg

Details for d5wmtb_

PDB Entry: 5wmt (more details), 2.75 Å

PDB Description: structure of grp94 n-terminal domain bound to resorcinylic inhibitor bnim.
PDB Compounds: (B:) Endoplasmin

SCOPe Domain Sequences for d5wmtb_:

Sequence, based on SEQRES records: (download)

>d5wmtb_ d.122.1.1 (B:) HSP90 {Dog (Canis familiaris) [TaxId: 9615]}
ksekfafqaevnrmmkliinslyknkeiflrelisnasdaldkirlisltdenalagnee
ltvkikcdkeknllhvtdtgvgmtreelvknlgtiaksgtseflnkmteaqedgqstsel
igqfgvgfysaflvadkvivtskhnndtqhiwesdsnefsviadprgntlgrgttitlvl
keeasdyleldtiknlvkkysqfinfpiyvwssktggggktvwdwelmn

Sequence, based on observed residues (ATOM records): (download)

>d5wmtb_ d.122.1.1 (B:) HSP90 {Dog (Canis familiaris) [TaxId: 9615]}
ksekfafqaevnrmmkliinslyknkeiflrelisnasdaldkirlisltdenalagnee
ltvkikcdkeknllhvtdtgvgmtreelvknlgtiaksgtsefqstseligqfgvgfysa
flvadkvivtskhnndtqhiwesdsnefsviadprgntlgrgttitlvlkeeasdyleld
tiknlvkkysqfinfpiyvwsskttvwdwelmn

SCOPe Domain Coordinates for d5wmtb_ are not available.

Timeline for d5wmtb_:

Domains from other chains:
(mouse over for more information)
d5wmta_, d5wmtc_, d5wmtd_