Lineage for d5xkfd1 (5xkf D:1-243)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2471420Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2471421Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) (S)
    automatically mapped to Pfam PF00091
  5. 2471422Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)
  6. 2471549Protein automated matches [226837] (10 species)
    not a true protein
  7. 2472102Species Pig (Sus scrofa) [TaxId:9823] [278808] (54 PDB entries)
  8. 2472245Domain d5xkfd1: 5xkf D:1-243 [351291]
    Other proteins in same PDB: d5xkfa2, d5xkfb2, d5xkfc2, d5xkfd2, d5xkfe_, d5xkff1, d5xkff2, d5xkff3
    automated match to d4drxb1
    complexed with 88u, ca, gdp, gol, gtp, mes, mg

Details for d5xkfd1

PDB Entry: 5xkf (more details), 2.8 Å

PDB Description: crystal structure of t2r-ttl-mpc6827 complex
PDB Compounds: (D:) Tubulin beta chain

SCOPe Domain Sequences for d5xkfd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xkfd1 c.32.1.1 (D:1-243) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
mreivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneatgnkyv
prailvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvv
rkesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvmpspkvsdtvv
epynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttcl
rfp

SCOPe Domain Coordinates for d5xkfd1:

Click to download the PDB-style file with coordinates for d5xkfd1.
(The format of our PDB-style files is described here.)

Timeline for d5xkfd1: