SCOPe 2.07: Domain d5xkfb2: 5xkf B:244-428

Lineage for d5xkfb2 (5xkf B:244-428)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families)

5. Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)

6. Protein automated matches [227071] (7 species)
   not a true protein

7. Species Pig (Sus scrofa) [TaxId:9823] [278816] (54 PDB entries)

8. Domain d5xkfb2: 5xkf B:244-428 [351287]
   Other proteins in same PDB: d5xkfa1, d5xkfb1, d5xkfc1, d5xkfd1, d5xkfe_, d5xkff1, d5xkff2, d5xkff3
   automated match to d3rycd2
   complexed with 88u, ca, gdp, gol, gtp, mes, mg

Details for d5xkfb2

PDB Entry: 5xkf, 2.8 Å

PDB Description: crystal structure of t2r-ttl-mpc6827 complex

PDB Compounds: (B:) Tubulin beta chain

SCOPe Domain Sequences for d5xkfb2:

Sequence; same for both SEQRES and ATOM records:

>d5xkfb2 d.79.2.1 (B:244-428) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
gqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdsknmmaac
dprhgryltvaaifrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkm
satfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyq
qyqda

Timeline for d5xkfb2:

• d5xkfb2 is new in SCOPe 2.07-stable
  
• d5xkfb2 appears in the current release, SCOPe 2.08