Lineage for d5xkfb2 (5xkf B:244-428)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2565345Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2565735Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) (S)
  5. 2565736Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)
  6. 2565857Protein automated matches [227071] (7 species)
    not a true protein
  7. 2566410Species Pig (Sus scrofa) [TaxId:9823] [278816] (54 PDB entries)
  8. 2566552Domain d5xkfb2: 5xkf B:244-428 [351287]
    Other proteins in same PDB: d5xkfa1, d5xkfb1, d5xkfc1, d5xkfd1, d5xkfe_, d5xkff1, d5xkff2, d5xkff3
    automated match to d3rycd2
    complexed with 88u, ca, gdp, gol, gtp, mes, mg

Details for d5xkfb2

PDB Entry: 5xkf (more details), 2.8 Å

PDB Description: crystal structure of t2r-ttl-mpc6827 complex
PDB Compounds: (B:) Tubulin beta chain

SCOPe Domain Sequences for d5xkfb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xkfb2 d.79.2.1 (B:244-428) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
gqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdsknmmaac
dprhgryltvaaifrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkm
satfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyq
qyqda

SCOPe Domain Coordinates for d5xkfb2:

Click to download the PDB-style file with coordinates for d5xkfb2.
(The format of our PDB-style files is described here.)

Timeline for d5xkfb2: