SCOPe 2.08: Domain d1raga1: 1rag A:1-150

Lineage for d1raga1 (1rag A:1-150)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.78: ATC-like [53670] (2 superfamilies)
   consists of two similar domains related by pseudo dyad; duplication
   core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families)

5. Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (4 proteins)

6. Protein Aspartate carbamoyltransferase catalytic subunit [53673] (7 species)

7. Species Escherichia coli [TaxId:562] [53674] (62 PDB entries)
   Uniprot P00479

8. Domain d1raga1: 1rag A:1-150 [35128]
   Other proteins in same PDB: d1ragb1, d1ragb2, d1ragd1, d1ragd2
   complexed with ctp, zn; mutant

Details for d1raga1

PDB Entry: 1rag, 2.5 Å

PDB Description: crystal structure of ctp-ligated t state aspartate transcarbamoylase at 2.5 angstroms resolution: implications for atcase mutants and the mechanism of negative cooperativity

PDB Compounds: (A:) Aspartate carbamoyltransferase catalytic chain

SCOPe Domain Sequences for d1raga1:

Sequence; same for both SEQRES and ATOM records:

>d1raga1 c.78.1.1 (A:1-150) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli [TaxId: 562]}
anplyqkhiisindlsrddlnlvlataaklkanpqpellkhkviascffeastrtrlsfe
tsmhrlgasvvgfsdsantslgkkgetladtisvistyvdaivmrhpqegaarlatefsg
nvpvlnagdgsnqhptqtlldlftiqetqg

Timeline for d1raga1:

• d1raga1 first appeared (with stable ids) in SCOP 1.55
  
• d1raga1 appears in SCOPe 2.07