SCOPe 2.07: Domain d6fr8a2: 6fr8 A:116-201

Lineage for d6fr8a2 (6fr8 A:116-201)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (17 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1235 PDB entries)

8. Domain d6fr8a2: 6fr8 A:116-201 [351278]
   Other proteins in same PDB: d6fr8a1, d6fr8b1
   automated match to d1j8hd2
   complexed with so4

Details for d6fr8a2

PDB Entry: 6fr8, 2.38 Å

PDB Description: ha1.7 human t-cell receptor specific for influenza virus epitope pkyvkqntlklat presented by human leukocyte antigen hla-dr0101

PDB Compounds: (A:) T-Cell Receptor HA1.7 alpha Chain

SCOPe Domain Sequences for d6fr8a2:

Sequence; same for both SEQRES and ATOM records:

>d6fr8a2 b.1.1.2 (A:116-201) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtf

Timeline for d6fr8a2:

• d6fr8a2 is new in SCOPe 2.07-stable
  
• d6fr8a2 appears in the current release, SCOPe 2.08