Lineage for d5vl8a1 (5vl8 A:14-133)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2396657Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 2396658Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) (S)
  5. 2396659Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)
  6. 2396981Protein automated matches [190191] (2 species)
    not a true protein
  7. 2397072Species Streptomyces avidinii [TaxId:1895] [189343] (64 PDB entries)
  8. 3051212Domain d5vl8a1: 5vl8 A:14-133 [351274]
    Other proteins in same PDB: d5vl8a2
    automated match to d2bc3b_
    complexed with cu, gol, s32

Details for d5vl8a1

PDB Entry: 5vl8 (more details), 1.7 Å

PDB Description: coordination chemistry within a protein host: regulation of the secondary coordination sphere
PDB Compounds: (A:) streptavidin

SCOPe Domain Sequences for d5vl8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vl8a1 b.61.1.1 (A:14-133) automated matches {Streptomyces avidinii [TaxId: 1895]}
eagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtal
gwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkv

SCOPe Domain Coordinates for d5vl8a1:

Click to download the PDB-style file with coordinates for d5vl8a1.
(The format of our PDB-style files is described here.)

Timeline for d5vl8a1:

  • d5vl8a1 appears in periodic updates to SCOPe 2.07 starting on 2018-04-19

View in 3D
Domains from same chain:
(mouse over for more information)
d5vl8a2