SCOPe 2.08: Domain d5vgpa1: 5vgp A:239-342

Lineage for d5vgpa1 (5vgp A:239-342)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d5vgpa1: 5vgp A:239-342 [351271]
   automated match to d1hzhh3

Details for d5vgpa1

PDB Entry: 5vgp, 2.12 Å

PDB Description: fc fragment of human igg1 antibody, from nist mab

PDB Compounds: (A:) Human Fc fragment with G1F/G0F glycan

SCOPe Domain Sequences for d5vgpa1:

Sequence; same for both SEQRES and ATOM records:

>d5vgpa1 b.1.1.2 (A:239-342) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeq
ynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiska

Timeline for d5vgpa1:

• d5vgpa1 first appeared in SCOPe 2.07