SCOPe 2.08: Domain d6fr6b2: 6fr6 B:116-242

Lineage for d6fr6b2 (6fr6 B:116-242)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d6fr6b2: 6fr6 B:116-242 [351250]
   Other proteins in same PDB: d6fr6a1, d6fr6b1
   automated match to d3gsnb2
   complexed with so4

Details for d6fr6b2

PDB Entry: 6fr6, 2.98 Å

PDB Description: ha1.7 human t-cell receptor specific for influenza virus epitope pkyvkqntlklat presented by human leukocyte antigen hla-dr0101

PDB Compounds: (B:) Human T-cell Receptor beta chain

SCOPe Domain Sequences for d6fr6b2:

Sequence; same for both SEQRES and ATOM records:

>d6fr6b2 b.1.1.2 (B:116-242) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lnkvfppevavfepseaeishtqkatlvclatgffpdhvelswwvngkevhsgvctdpqp
lkeqpalndsryslssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivs
aeawgra

Timeline for d6fr6b2:

• d6fr6b2 first appeared in SCOPe 2.07