Lineage for d6furb1 (6fur B:1-111)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. Protein automated matches [190740] (30 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1747 PDB entries)
  8. Domain d6furb1: 6fur B:1-111 [351247]
    Other proteins in same PDB: d6fura2, d6furc2
    automated match to d2nw2b1
    complexed with edo, gol, so4

Details for d6furb1

PDB Entry: 6fur (more details), 1.7300000000000002 Å

PDB Description: f11 t-cell receptor recognising pkyvkqntlklat peptide presented by hla-dr*0101
PDB Compounds: (B:) Human F11 T-Cell Receptor

SCOPe Domain Sequences for d6furb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6furb1 b.1.1.0 (B:1-111) automated matches {Human (Homo sapiens) [TaxId: 9606]}
advtqtprnritktgkrimlecsqtkghdrmywyrqdpglglrliyysfdvkdinkgeis
dgysvsrqaqakfslslesaipnqtalyfcatsdesygytfgsgtrltvve

SCOPe Domain Coordinates for d6furb1 are not available.

Timeline for d6furb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6furb2
View in 3D
Domains from other chains:
(mouse over for more information)
d6fura1, d6fura2, d6furc1, d6furc2, d6furd1, d6furd2