Lineage for d6fr3b1 (6fr3 B:1-115)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. Protein automated matches [190740] (30 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1747 PDB entries)
  8. Domain d6fr3b1: 6fr3 B:1-115 [351240]
    Other proteins in same PDB: d6fr3a2
    automated match to d3q5ya1
    complexed with edo, peg

Details for d6fr3b1

PDB Entry: 6fr3 (more details), 1.35 Å

PDB Description: 003 tcr study of cdr loop flexibility
PDB Compounds: (B:) 003 TCR Beta Chain

SCOPe Domain Sequences for d6fr3b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6fr3b1 b.1.1.0 (B:1-115) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mkagvtqtpryliktrgqqvtlscspisghrsvswyqqtpgqglqflfeyfsetqrnkgn
fpgrfsgrqfsnsrsemnvstlelgdsalylcassfdsgnsplhfgngtrltvte

SCOPe Domain Coordinates for d6fr3b1 are not available.

Timeline for d6fr3b1:

Domains from same chain:
(mouse over for more information)
d6fr3b2
Domains from other chains:
(mouse over for more information)
d6fr3a1, d6fr3a2