Lineage for d6fr5a2 (6fr5 A:114-203)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2348364Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2352435Protein automated matches [190374] (17 species)
    not a true protein
  7. 2352460Species Human (Homo sapiens) [TaxId:9606] [187221] (1235 PDB entries)
  8. 3051177Domain d6fr5a2: 6fr5 A:114-203 [351239]
    Other proteins in same PDB: d6fr5a1, d6fr5b1, d6fr5b2
    automated match to d2pyfa2
    complexed with act, edo, gol

Details for d6fr5a2

PDB Entry: 6fr5 (more details), 1.37 Å

PDB Description: ha1.7 tcr study of cdr loop flexibility
PDB Compounds: (A:) TCR HA1.7 specific for FLU epitope PKYVKQNTLKLAT, alpha chain

SCOPe Domain Sequences for d6fr5a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6fr5a2 b.1.1.2 (A:114-203) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffpsp

SCOPe Domain Coordinates for d6fr5a2:

Click to download the PDB-style file with coordinates for d6fr5a2.
(The format of our PDB-style files is described here.)

Timeline for d6fr5a2:

  • d6fr5a2 is new in SCOPe 2.07-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d6fr5a1