Lineage for d6frca2 (6frc A:113-202)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2749887Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
  8. 2750038Domain d6frca2: 6frc A:113-202 [351231]
    Other proteins in same PDB: d6frca1, d6frcb1, d6frcb2
    automated match to d2ak4d2
    complexed with edo, gol, peg, so4

Details for d6frca2

PDB Entry: 6frc (more details), 1.59 Å

PDB Description: f11 t-cell receptor recognising pkyvkqntlklat peptide presented by hla-dr*0101
PDB Compounds: (A:) Human T-Cell Receptor F11 alpha Chain

SCOPe Domain Sequences for d6frca2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6frca2 b.1.1.2 (A:113-202) automated matches {Human (Homo sapiens) [TaxId: 9606]}
niqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksn
savawsnksdfacanafnnsiipedtffps

SCOPe Domain Coordinates for d6frca2:

Click to download the PDB-style file with coordinates for d6frca2.
(The format of our PDB-style files is described here.)

Timeline for d6frca2:

View in 3D
Domains from same chain:
(mouse over for more information)
d6frca1