Lineage for d6en9l_ (6en9 L:)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3018743Fold e.18: HydB/Nqo4-like [56761] (1 superfamily)
    3 domains: (1) all-alpha; (2&3) alpha+beta
  4. 3018744Superfamily e.18.1: HydB/Nqo4-like [56762] (3 families) (S)
  5. 3018909Family e.18.1.0: automated matches [191637] (1 protein)
    not a true family
  6. 3018910Protein automated matches [191173] (18 species)
    not a true protein
  7. 3018941Species Escherichia coli [TaxId:562] [195685] (6 PDB entries)
  8. 3018950Domain d6en9l_: 6en9 L: [351226]
    Other proteins in same PDB: d6en9s_, d6en9t_
    automated match to d3myrd_
    complexed with f3s, fco, mg, ni, sf4, so4

Details for d6en9l_

PDB Entry: 6en9 (more details), 1.5 Å

PDB Description: e. coli hydrogenase-2 (hydrogen reduced form)
PDB Compounds: (L:) Hydrogenase-2 large chain

SCOPe Domain Sequences for d6en9l_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6en9l_ e.18.1.0 (L:) automated matches {Escherichia coli [TaxId: 562]}
sqritidpvtrieghlridceiengvvskawasgtmwrgmeeivknrdprdawmivqric
gvcttthalssvraaesalnidvpvnaqyirniilaahtthdhivhfyqlsaldwvdits
alqadptkasemlkgvstwhlnspeeftkvqnkikdlvasgqlgifangywghpamklpp
evnliavahylqalecqrdanrvvallggktphiqnlavggvanpinldglgvlnlerlm
yiksfidklsdfveqvykvdtaviaafypewltrgkgavnylsvpefptdskngsflfpg
gyienadlssyrpitshsdeylikgiqesakhswykdeapqapwegttipaydgwsddgk
yswvksptfygktvevgplanmlvklaagrestqnklneivaiyqkltgntlevaqlhst
lgriigrtvhccelqdilqnqysalitnigkgdhttfvkpnipatgefkgvgfleaprgm
lshwmvikdgiisnyqavvpstwnsgprnfnddvgpyeqslvgtpvadpnkplevvrtih
sfdpcmacavh

SCOPe Domain Coordinates for d6en9l_:

Click to download the PDB-style file with coordinates for d6en9l_.
(The format of our PDB-style files is described here.)

Timeline for d6en9l_: