Lineage for d6fuqa2 (6fuq A:113-202)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. Protein automated matches [190374] (15 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1239 PDB entries)
  8. Domain d6fuqa2: 6fuq A:113-202 [351225]
    Other proteins in same PDB: d6fuqa1, d6fuqb1, d6fuqb2
    automated match to d2ak4d2
    complexed with edo, peg, so4

Details for d6fuqa2

PDB Entry: 6fuq (more details), 1.6 Å

PDB Description: f11 t-cell receptor recognising pkyvkqntlklat peptide presented by hla-dr*0101
PDB Compounds: (A:) Human F11 T-Cell Receptor

SCOPe Domain Sequences for d6fuqa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6fuqa2 b.1.1.2 (A:113-202) automated matches {Human (Homo sapiens) [TaxId: 9606]}
niqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksn
savawsnksdfacanafnnsiipedtffps

SCOPe Domain Coordinates for d6fuqa2 are not available.

Timeline for d6fuqa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d6fuqa1
View in 3D
Domains from other chains:
(mouse over for more information)
d6fuqb1, d6fuqb2