Lineage for d6ehqm_ (6ehq M:)

  1. Root: SCOPe 2.08
  2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. Fold e.18: HydB/Nqo4-like [56761] (1 superfamily)
    3 domains: (1) all-alpha; (2&3) alpha+beta
  4. Superfamily e.18.1: HydB/Nqo4-like [56762] (3 families) (S)
  5. Family e.18.1.0: automated matches [191637] (1 protein)
    not a true family
  6. Protein automated matches [191173] (15 species)
    not a true protein
  7. Species Escherichia coli [TaxId:83333] [330666] (14 PDB entries)
  8. Domain d6ehqm_: 6ehq M: [351221]
    Other proteins in same PDB: d6ehqs_, d6ehqt_
    automated match to d3myrd_
    complexed with f3s, fco, mg, ni, sf4

Details for d6ehqm_

PDB Entry: 6ehq (more details), 2.2 Å

PDB Description: e. coli hydrogenase-2 (as isolated form).
PDB Compounds: (M:) Hydrogenase-2 large chain

SCOPe Domain Sequences for d6ehqm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ehqm_ e.18.1.0 (M:) automated matches {Escherichia coli [TaxId: 83333]}
sqritidpvtrieghlridceiengvvskawasgtmwrgmeeivknrdprdawmivqric
gvcttthalssvraaesalnidvpvnaqyirniilaahtthdhivhfyqlsaldwvdits
alqadptkasemlkgvstwhlnspeeftkvqnkikdlvasgqlgifangywghpamklpp
evnliavahylqalecqrdanrvvallggktphiqnlavggvanpinldglgvlnlerlm
yiksfidklsdfveqvykvdtaviaafypewltrgkgavnylsvpefptdskngsflfpg
gyienadlssyrpitshsdeylikgiqesakhswykdeapqapwegttipaydgwsddgk
yswvksptfygktvevgplanmlvklaagrestqnklneivaiyqkltgntlevaqlhst
lgriigrtvhccelqdilqnqysalitnigkgdhttfvkpnipatgefkgvgfleaprgm
lshwmvikdgiisnyqavvpstwnsgprnfnddvgpyeqslvgtpvadpnkplevvrtih
sfdpcmacavh

SCOPe Domain Coordinates for d6ehqm_ are not available.

Timeline for d6ehqm_:

View in 3D
Domains from other chains:
(mouse over for more information)
d6ehql_, d6ehqs_, d6ehqt_