SCOP 1.57: Domain d1raic1: 1rai C:1-150

Lineage for d1raic1 (1rai C:1-150)

1. Root: SCOP 1.57

2. Class c: Alpha and beta proteins (a/b) [51349] (107 folds)

3. Fold c.78: ATC-like [53670] (2 superfamilies)

4. Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (1 family)

5. Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (2 proteins)

6. Protein Aspartate carbamoyltransferase catalytic subunit [53673] (2 species)

7. Species Escherichia coli [TaxId:562] [53674] (28 PDB entries)

8. Domain d1raic1: 1rai C:1-150 [35122]
   Other proteins in same PDB: d1raib1, d1raib2, d1raid1, d1raid2

Details for d1raic1

PDB Entry: 1rai, 2.5 Å

PDB Description: crystal structure of ctp-ligated t state aspartate transcarbamoylase at 2.5 angstroms resolution: implications for atcase mutants and the mechanism of negative cooperativity

SCOP Domain Sequences for d1raic1:

Sequence; same for both SEQRES and ATOM records:

>d1raic1 c.78.1.1 (C:1-150) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli}
anplyqkhiisindlsrddlnlvlataaklkanpqpellkhkviascffeastrtrlsfe
tsmhrlgasvvgfsdsantslgkkgetladtisvistyvdaivmrhpqegaarlatefsg
nvpvlnagdgsnqhptqtlldlftiqetqg

Timeline for d1raic1:

• d1raic1 first appeared (with stable ids) in SCOP 1.55
  
• d1raic1 appears in SCOP 1.59
  
• d1raic1 appears in the current release, SCOPe 2.08