Lineage for d6fr4a1 (6fr4 A:1-113)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. Protein automated matches [190740] (30 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1747 PDB entries)
  8. Domain d6fr4a1: 6fr4 A:1-113 [351217]
    Other proteins in same PDB: d6fr4a2
    automated match to d2pyfa1
    complexed with act, edo, gol

Details for d6fr4a1

PDB Entry: 6fr4 (more details), 1.28 Å

PDB Description: 003 tcr study of cdr loop flexibility
PDB Compounds: (A:) TCR 003 alpha chain

SCOPe Domain Sequences for d6fr4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6fr4a1 b.1.1.0 (A:1-113) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mkqevtqipaalsvpegenlvlncsftdsaiynlqwfrqdpgkgltsllliqssqreqts
grlnasldkssgrstlyiaasqpgdsatylcavtnfnkfyfgsgtklnvkpn

SCOPe Domain Coordinates for d6fr4a1 are not available.

Timeline for d6fr4a1:

Domains from same chain:
(mouse over for more information)
d6fr4a2
Domains from other chains:
(mouse over for more information)
d6fr4b1, d6fr4b2