Lineage for d6frab2 (6fra B:112-240)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. Protein automated matches [190740] (30 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1747 PDB entries)
  8. Domain d6frab2: 6fra B:112-240 [351210]
    Other proteins in same PDB: d6fraa2
    automated match to d2nw2b2
    complexed with edo, so4

Details for d6frab2

PDB Entry: 6fra (more details), 1.7300000000000002 Å

PDB Description: f11 t-cell receptor recognising pkyvkqntlklat peptide presented by hla-dr*0101
PDB Compounds: (B:) Human T-Cell Receptor F11 beta Chain

SCOPe Domain Sequences for d6frab2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6frab2 b.1.1.0 (B:112-240) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlnkvsppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq
plkeqpalndsryslssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgrad

SCOPe Domain Coordinates for d6frab2 are not available.

Timeline for d6frab2:

View in 3D
Domains from same chain:
(mouse over for more information)
d6frab1
View in 3D
Domains from other chains:
(mouse over for more information)
d6fraa1, d6fraa2