Lineage for d6ehqt_ (6ehq T:)

  1. Root: SCOPe 2.08
  2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. Fold e.19: HydA/Nqo6-like [56769] (1 superfamily)
    2 domains: (1) alpa/beta; (2) Fe-S cluster-bound
  4. Superfamily e.19.1: HydA/Nqo6-like [56770] (3 families) (S)
  5. Family e.19.1.0: automated matches [191636] (1 protein)
    not a true family
  6. Protein automated matches [191172] (11 species)
    not a true protein
  7. Species Escherichia coli [TaxId:83333] [351202] (9 PDB entries)
  8. Domain d6ehqt_: 6ehq T: [351203]
    Other proteins in same PDB: d6ehql_, d6ehqm_
    automated match to d3myrc_
    complexed with f3s, fco, mg, ni, sf4

Details for d6ehqt_

PDB Entry: 6ehq (more details), 2.2 Å

PDB Description: e. coli hydrogenase-2 (as isolated form).
PDB Compounds: (T:) Hydrogenase-2 small chain

SCOPe Domain Sequences for d6ehqt_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ehqt_ e.19.1.0 (T:) automated matches {Escherichia coli [TaxId: 83333]}
pqrppviwigaqectgctesllrathptvenlvletisleyhevlsaafghqveenkhna
lekykgqyvlvvdgsiplkdngiycmvagepivdhirkaaegaaaiiaigscsawggvaa
agvnptgavslqevlpgktvinipgcppnphnflatvahiitygkppklddknrptfayg
rlihehcerrphfdagrfakefgdeghregwclyhlgckgpetygncstlqfcdvggvwp
vaighpcygcneegigfhkgihqlanve

SCOPe Domain Coordinates for d6ehqt_ are not available.

Timeline for d6ehqt_:

View in 3D
Domains from other chains:
(mouse over for more information)
d6ehql_, d6ehqm_, d6ehqs_