Lineage for d5at1c2 (5at1 C:151-310)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 249567Fold c.78: ATC-like [53670] (2 superfamilies)
    consists of two similar domains related by pseudodyad; duplication
    core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134
  4. 249568Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (1 family) (S)
  5. 249569Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (3 proteins)
  6. 249570Protein Aspartate carbamoyltransferase catalytic subunit [53673] (3 species)
  7. 249581Species Escherichia coli [TaxId:562] [53674] (29 PDB entries)
  8. 249615Domain d5at1c2: 5at1 C:151-310 [35119]
    Other proteins in same PDB: d5at1b1, d5at1b2, d5at1d1, d5at1d2
    complexed with ctp, zn

Details for d5at1c2

PDB Entry: 5at1 (more details), 2.6 Å

PDB Description: structural consequences of effector binding to the t state of aspartate carbamoyltransferase. crystal structures of the unligated and atp-, and ctp-complexed enzymes at 2.6-angstroms resolution

SCOP Domain Sequences for d5at1c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5at1c2 c.78.1.1 (C:151-310) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli}
rldnlhvamvgdlkygrtvhsltqalakfdgnrfyfiapdalampeyildmldekgiaws
lhssieevmaevdilymtrvqkerldpseyanvkaqfvlrasdlhnakanmkvlhplprv
deiatdvdktphawyfqqagngifarqallalvlnrdlvl

SCOP Domain Coordinates for d5at1c2:

Click to download the PDB-style file with coordinates for d5at1c2.
(The format of our PDB-style files is described here.)

Timeline for d5at1c2: